PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna12564.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 401aa    MW: 44822.8 Da    PI: 6.9767
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna12564.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding506.9e-161475148
                             TSSS-HHHHHHHHHHHHHTTTT..............-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg..............tWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WTteEde+lv++ ++ Gg+              +W+ +++  g++R++k+c++rw +yl
  mrna12564.1-v1.0-hybrid 14 KGPWTTEEDEKLVEYMERCGGDgshhhhhhhhrggiSWRQVPKLAGLKRCGKSCRLRWTNYL 75
                             79**********************************************************97 PP

2Myb_DNA-binding521.7e-1681125147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              rg+++ +E+e +++++k+lG++ W++Ia+ ++ gRt++++k++w+++
  mrna12564.1-v1.0-hybrid  81 RGNFSHQEEETIINLHKLLGNK-WSAIASNLP-GRTDNEIKNFWNTH 125
                              89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.1E-20578IPR009057Homeodomain-like
PROSITE profilePS5129411.38975IPR017930Myb domain
SuperFamilySSF466891.68E-2511122IPR009057Homeodomain-like
SMARTSM007174.1E-121377IPR001005SANT/Myb domain
PfamPF002499.2E-141475IPR001005SANT/Myb domain
CDDcd001674.31E-71675No hitNo description
PROSITE profilePS5129424.92376130IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.2E-2679130IPR009057Homeodomain-like
SMARTSM007178.9E-1680128IPR001005SANT/Myb domain
PfamPF002494.8E-1581125IPR001005SANT/Myb domain
CDDcd001671.86E-1183126No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 401 aa     Download sequence    Send to blast
MGRSACCDES GLKKGPWTTE EDEKLVEYME RCGGDGSHHH HHHHHRGGIS WRQVPKLAGL  60
KRCGKSCRLR WTNYLRPDIK RGNFSHQEEE TIINLHKLLG NKWSAIASNL PGRTDNEIKN  120
FWNTHVKKKL LQMGIDPVTH TPLLTTTHDH LSTIAAASTS FNPCDWALLQ YLNSKIQVLQ  180
NNIRQGQGLL ISNKTASDAY DQCRPCMPGM EMEAAAVDYY KHVLGSAPSS SSSFLDQQPV  240
YHPGHGIGYD YADLTSATMV NRQSNGFEGT SFRNTNEYDH HYSKFSIPNR KAPSSTEDEH  300
KLQYGHGQSG TYDHQLPVLV PAATSPYATG STHDTTAITP PELMMHHFPN SIHSSTTTTS  360
TATFQIDYGV ACDGRDLIVM DGDHHQEATN DQSYWKHIME *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-25121305108B-MYB
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004309069.20.0PREDICTED: uncharacterized protein LOC101292853
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16770.21e-67myb domain protein 9